Loading product
Flat $14.95 contiguous-US shipping under 6 vials. 6+ vials use the bulk freight estimate at checkout.
Loading product
Research compound
VIP is a defined neuropeptide supplied for receptor research. Research use only. Not for human or animal use.
10mg · lyophilized research compound
Certificate of analysis
Certificates of Analysis are available on request.
Cancel anytime. Shipping $14.95 per delivery under 6 vials; 6 or more use the bulk freight estimate.
We'll email you to confirm before each delivery ships.
One discount per order. Offers don't combine.
For qualified laboratory research only. Not for human or veterinary use. Not a drug, supplement, food, cosmetic, or device. Not for diagnosis, treatment, cure, or prevention of any disease. Not evaluated by the FDA. Any use outside laboratory research is the purchaser’s responsibility.
Published reference notes for laboratory context. For research use only. Not for human or animal use. Not a diagnostic or therapeutic claim.
Identity. Vasoactive intestinal peptide is the 28-aa neuropeptide HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 acting at VPAC1/VPAC2 class B GPCRs. In research (medical). VIP is studied in neuroimmune, circadian, and pulmonary inflammation models. Not FDA-approved as a general VIP drug under this listing. In plain English. Scientists study VIP as a gut-and-nerve signalling peptide that also talks to immune and lung pathways in research models. Sold for laboratory research only -- not for human use.
Supplied as a lyophilized powder in a sealed vial. Recommended storage is −20 °C. Materials should be handled only by trained laboratory personnel using appropriate personal protective equipment. The Certificate of Analysis for a lot (available on request) covers identity, purity, and any lot-specific notes.
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR ANIMAL USE. This product is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated or approved by the FDA for any use other than laboratory research. Not for diagnostic or therapeutic use. Sale is restricted to qualified research professionals and institutions.
For research use only. Not for human or animal use.
VIP research notes: sequence, mass, cited laboratory literature, and storage.
