Loading product
Flat $14.95 contiguous-US shipping under 6 vials. 6+ vials use the bulk freight estimate at checkout.
Loading product
Research compound
This row is the research solid of GHRH(1-29) amide as the acetate salt. Research use only. Not for human or animal use.
10mg · lyophilized research compound
Certificate of analysis
Certificates of Analysis are available on request.
Cancel anytime. Shipping $14.95 per delivery under 6 vials; 6 or more use the bulk freight estimate.
We'll email you to confirm before each delivery ships.
One discount per order. Offers don't combine.
For qualified laboratory research only. Not for human or veterinary use. Not a drug, supplement, food, cosmetic, or device. Not for diagnosis, treatment, cure, or prevention of any disease. Not evaluated by the FDA. Any use outside laboratory research is the purchaser’s responsibility.
In a research bundle
Vials show list price; the cart applies one offer per order.
Published reference notes for laboratory context. For research use only. Not for human or animal use. Not a diagnostic or therapeutic claim.
Identity. Sermorelin acetate is GHRH(1-29)-NH2 (sequence YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; mass near 3358 Da). In research (medical). It is the shortest fully active fragment of growth-hormone-releasing hormone at the GHRH receptor and has a history as a diagnostic/research GH-axis probe; a former US brand (Geref) was discontinued. This listing is research material, not a current finished-drug claim. In plain English. Sermorelin is the short active piece of the body's own growth-hormone-releasing hormone, used in labs to study that signalling pathway. Sold for laboratory research only -- not for human use.
Supplied as a lyophilized powder in a sealed vial. Recommended storage is −20 °C. Materials should be handled only by trained laboratory personnel using appropriate personal protective equipment. The Certificate of Analysis for a lot (available on request) covers identity, purity, and any lot-specific notes.
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR ANIMAL USE. This product is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated or approved by the FDA for any use other than laboratory research. Not for diagnostic or therapeutic use. Sale is restricted to qualified research professionals and institutions.
For research use only. Not for human or animal use.
Sermorelin Acetate research notes: sequence, mass, cited laboratory literature, and storage.
Latest published studies · GH secretagogues
